Recombinant Full Length Rhizobium Radiobacter Conjugal Transfer Protein Trbi(Trbi) Protein, His-Tagged
Cat.No. : | RFL18154RF |
Product Overview : | Recombinant Full Length Rhizobium radiobacter Conjugal transfer protein trbI(trbI) Protein (P54917) (1-433aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-433) |
Form : | Lyophilized powder |
AA Sequence : | MVQSLNLGGAQNSQAASGIRRINRLPIVVVIVLAVAFLGIIFYGLASRGLYFGRDKGPES SSGEPASTFADQIKRGVTDGIIGEPQQQTTFQPTPVETKQVDEKASNPFTPTPEQRRGQE LEPEAVWRARLEREQQEQYLRERQRQRMARLQANDAAYDAPLAIDRGKLEARTATDDTSA ANTSTAISPTAGASDLYAAALRAGLGGQNIDPNGQKSKEDFFNTDLKDLGYLPNRVVPQQ SLYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHRLLIPQGTKLFGRYDSKV SFGQSRVLVVWSDIIFPNGSTLQIVGMAGTDAEGYGGFKDKVNNHYFKTFGSAVMIALIG TGIDMSVPQSSTLATQDTASDAARRNFAETFGRVADRTIQRNMDVQPTLEIRPGYKFNVL VDQDIIFNGIYRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trbI |
Synonyms | trbI; Conjugal transfer protein TrbI |
UniProt ID | P54917 |
◆ Native Proteins | ||
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
Calprotectin-12HFL | Native Human Calprotectin Protein | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB2A-1026DCL | Recombinant Danio rerio (zebrafish) EFNB2A cell lysate | +Inquiry |
CPSF3-7304HCL | Recombinant Human CPSF3 293 Cell Lysate | +Inquiry |
FAM71F2-267HCL | Recombinant Human FAM71F2 lysate | +Inquiry |
ATG4B-8624HCL | Recombinant Human ATG4B 293 Cell Lysate | +Inquiry |
WARS2-369HCL | Recombinant Human WARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trbI Products
Required fields are marked with *
My Review for All trbI Products
Required fields are marked with *
0
Inquiry Basket