Recombinant Full Length Rhizobium Meliloti Rpoh Suppressor(Suhr) Protein, His-Tagged
Cat.No. : | RFL1284RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti RpoH suppressor(suhR) Protein (P15715) (1-633aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-633) |
Form : | Lyophilized powder |
AA Sequence : | MARTPAKYCDLVMKGGITSGIVYPNAALALARDYRFKNIGGTSAGAIAAAACAAAAVGDR RKQMKAAIAQPEERVGFEGLAKASANLASPGFIKDLLQPAAGAGQAFRLLVTLAGNTGVL RKGVALLGSVVRIAPVETLLLLAALAGLAYAVGGQTGMIAAALPAAICAYLGGVVFAVLR IARVLRRNLMGLCTGTAPDQPARRPRMVLTDWLHETLQALSGKASGQPLTFGDLWTAERY PGEPGSDRAVTLKMITTGISHQEPRSLPFESALFWFRRKEFEALFPKVVVDWMVEKAGEP VTVAGEDYYLLPHGADMPVLVATRMSLSFPLLISAVPLHEPARRESLPGSDGENEAEDTT SDEDEQKTVLDSTEALTTGGKKRRARPAAFRICWFSDGGISSNFPIHLFDRALPRWPTFA INLVYPETSDTGSRPEVFLPENNRQGWQRHYQPIARKSAVHELCAFVFAIVATMQNWRDL LQSRAPGHRERIVHVSLSPQEGGLNLAMSKEVLAAVSKKGTAAGEAFARFSFENHYWIRW RNLASALQRYTIDIAASDAYRPKIPDYEPAYALAHDATSKPPSYRFASKAEREEAARLLE KLIGEGEKWSGEGPDLTKTAPRPLPQLQIAPTY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | suhR |
Synonyms | suhR; R02096; SMc01492; RpoH suppressor |
UniProt ID | P15715 |
◆ Recombinant Proteins | ||
Acd-482R | Recombinant Rat Acd Protein, His-tagged | +Inquiry |
NI36-RS05245-1067S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS05245 protein, His-tagged | +Inquiry |
Klk11-3724M | Recombinant Mouse Klk11 Protein, Myc/DDK-tagged | +Inquiry |
IBSP-376H | Recombinant Human IBSP Protein, His-tagged | +Inquiry |
FOSL2-4428H | Recombinant Human FOSL2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEPP-1147HCL | Recombinant Human TEPP 293 Cell Lysate | +Inquiry |
LNCaP-052HCL | Human LNCaP Whole Cell Lysate | +Inquiry |
ERF-6561HCL | Recombinant Human ERF 293 Cell Lysate | +Inquiry |
SNRPC-616HCL | Recombinant Human SNRPC lysate | +Inquiry |
LGALS9B-378HCL | Recombinant Human LGALS9B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All suhR Products
Required fields are marked with *
My Review for All suhR Products
Required fields are marked with *
0
Inquiry Basket