Recombinant Full Length Rhizobium Meliloti Putative Cyclic Beta-1,2-Glucan Modification Protein(Cgma) Protein, His-Tagged
Cat.No. : | RFL25488RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Putative cyclic beta-1,2-glucan modification protein(cgmA) Protein (P72302) (1-639aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-639) |
Form : | Lyophilized powder |
AA Sequence : | MARIDSAVSSSQVYADGESSSARYTRTLSGARSALFTLLIAIALVFTVEVIVRWSWPDTV AYFADPMRPAWTTVAVFFLAMLGVDALFGREHKAALLIAPLAVVPAFISQQKQVFLSDPL YPTDFLFGRQIMELMPVLVKDRPWTAVGVVAGLIAAIVVGALLLRFAWQNFPKLTRRERL MRIAFALPLLVAFWNIMDYNQFSWIRDRLRVIPIMWDQTENYRHNGFALAFAINLPMANV NAPAGYMADAIDRIPVKPLPAGTTHRGKPDVIVLMSESFWDPTRLPKVKLTPDPMPTIRE LQGGNVFSPEFGGMTANVEFEALTGFSNAFLPYGSIPYQQYIRNPIPSLATFFRGEGYVS RAIHPFQGWFWNRTAVYKAFGFDMFRSEENMPAMQKRGIFASDESLTKEIIRQADEVEDP FFFFAVTLQGHGPYEANRYAKNTIKVEGDLPEADRQVLATYAQGVKEADDSLKMLMDWAK ERDRETIIVLFGDHLPPLNTVYSSTGYMKGITAERKGPKDQMKAEHETPLVVWSNKTGPK KNIGTISPAFLSYQILKQAGYEHPYYTGFLGKVYDHYRVLDRYMLIRKNGKDVADWLRQP KVPASLRDYRFLQHDMMFGKRYSTERFFKSHAELYSAGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cgmA |
Synonyms | cgmA; R01848; SMc00195; Putative cyclic beta-1,2-glucan modification protein |
UniProt ID | P72302 |
◆ Recombinant Proteins | ||
Ntan1-4518M | Recombinant Mouse Ntan1 Protein, Myc/DDK-tagged | +Inquiry |
CST4-27162TH | Recombinant Human CST4 | +Inquiry |
CD274-1058CAF555 | Recombinant Canine CD274 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
SCO3854-1180S | Recombinant Streptomyces coelicolor A3(2) SCO3854 protein, His-tagged | +Inquiry |
FTSJ3-4539H | Recombinant Human FTSJ3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
COP34 | Native Ginkgo Biloba L. EP7 | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMX2-5464HCL | Recombinant Human HMX2 293 Cell Lysate | +Inquiry |
ZNF167-1990HCL | Recombinant Human ZNF167 cell lysate | +Inquiry |
CAB39L-7911HCL | Recombinant Human CAB39L 293 Cell Lysate | +Inquiry |
MANSC1-4518HCL | Recombinant Human MANSC1 293 Cell Lysate | +Inquiry |
IL1R1-1787MCL | Recombinant Mouse IL1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cgmA Products
Required fields are marked with *
My Review for All cgmA Products
Required fields are marked with *
0
Inquiry Basket