Recombinant Full Length Rhizobium Meliloti Nodulation Protein E(Node) Protein, His-Tagged
Cat.No. : | RFL306RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Nodulation protein E(nodE) Protein (P06230) (1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-402) |
Form : | Lyophilized powder |
AA Sequence : | MDRRVVITGMGGLCGLGTDTTSIWKWMREGRSAIGPLLNTELHGLKGIVGAEVKALPDHN IDRKQLVSMDRISVLAVIAAHEAMRQAGLSCNEGNALRFGATVGVGLGGWDATEKAYRTL LVDGGTRTEIFTGVKAMPSAAACQVSMSLGLRGPVFGVTSACSSANHAIASAVDQIKCGR ADVMLAGGSDAPLVWIVLKAWEAMRALAPDTCRPFSAGRKGVVLGEGAGMAVLESYEHAT ARGATILAEVAGVGLSADAFHITAPAVHGPESAMRACLADAGLNAEDVDYLNAHGTGTKA NDQNETTAIKRVFGDHAYSMSISSTKSTHAHCIGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVPRERKVRVAMSNAFAMGGTNAVLAFKQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nodE |
Synonyms | nodE; hsnB; RA0466; SMa0853; Nodulation protein E; Host-specificity of nodulation protein B |
UniProt ID | P06230 |
◆ Recombinant Proteins | ||
CD83-051H | Recombinant Human CD83 Protein, Fc-tagged | +Inquiry |
CHCHD3-582H | Recombinant Human CHCHD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRPH-01H | Recombinant Human PRPH Protein, His-tagged | +Inquiry |
RBM3-3413H | Recombinant Human RBM3 protein, His-SUMO-tagged | +Inquiry |
ALDH18A1-449M | Recombinant Mouse ALDH18A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Esophagus-720P | Pig Esophagus Lysate, Total Protein | +Inquiry |
PNPLA5-3066HCL | Recombinant Human PNPLA5 293 Cell Lysate | +Inquiry |
ZFP90-1978HCL | Recombinant Human ZFP90 cell lysate | +Inquiry |
ENTPD4-6592HCL | Recombinant Human ENTPD4 293 Cell Lysate | +Inquiry |
MTO1-4069HCL | Recombinant Human MTO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nodE Products
Required fields are marked with *
My Review for All nodE Products
Required fields are marked with *
0
Inquiry Basket