Recombinant Full Length Rhizobium Meliloti C4-Dicarboxylate Transport Sensor Protein Dctb(Dctb) Protein, His-Tagged
Cat.No. : | RFL12374RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti C4-dicarboxylate transport sensor protein dctB(dctB) Protein (P13633) (1-621aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-621) |
Form : | Lyophilized powder |
AA Sequence : | MHHVRMVKLPAEASDPHALRSRARRSWLVFAAVALVLLAAGLLLARDYGRSQALAGLAGQ SRIDASLKASLLRAVVERQRALPLVLADDAAIRGALLSPDRPSLDRINRKLEALATSAEA AVIYLIDRSGVAVAASNWQEPTSFVGNDYAFRDYFRLAVRDGMAEHFAMGTVSNRPGLYI SRRVDGPGGPLGVIVAKLEFDGVEADWQASGKPAYVTDRRGIVLITSLPSWRFMTTKPIA EDRLAPIRESLQFGDAPLLPLPFRKIEARPDGSSTLDALLPGDSTAAFLRVETMVPSTNW RLEQLSPLKAPLAAGAREAQLLTLAALVPLLALAALLLRRRQVVAMRSAEERLARNALEA SVEERTRDLRMARDRLETEIADHRQTTEKLQAVQQDLVQANRLAILGQVAAGVAHEINQP VATIRAYADNARTFLHRGQTVTAAENMESIAELTERVGAITDELRRFARKGHFAAGPTAM KEVVEGALMLLRSRFAGRMDAIRLDLPPDGLQALGNRIRLEQVLINLLQNALEAIGDSED GAIQVRCEEAAGGIALTVADNGPGIAADVREELFTPFNTSKEDGLGLGLAISKEIVSDYG GTIEVESGPSGTTFAVNLKKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctB |
Synonyms | dctB; RB1524; SMb20612; C4-dicarboxylate transport sensor protein DctB |
UniProt ID | P13633 |
◆ Recombinant Proteins | ||
RFL28196SF | Recombinant Full Length Staphylococcus Aureus Uncharacterized Sensor-Like Histidine Kinase Sas0199(Sas0199) Protein, His-Tagged | +Inquiry |
CD209-3033HF | Recombinant Full Length Human CD209 Protein | +Inquiry |
RNASE2-2832H | Recombinant Human RNASE2 Protein, His-tagged, OVA Conjugated | +Inquiry |
CDKN1B-3221M | Recombinant Mouse CDKN1B Protein | +Inquiry |
Rbbp9-5644M | Recombinant Mouse Rbbp9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
Immunoglobulin G2-82H | Native Human Immunoglobulin G2 | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FEN1-6264HCL | Recombinant Human FEN1 293 Cell Lysate | +Inquiry |
KLHL4-944HCL | Recombinant Human KLHL4 cell lysate | +Inquiry |
STAMBP-1427HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
SNRPB2-1615HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
Pine-705P | Pine Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dctB Products
Required fields are marked with *
My Review for All dctB Products
Required fields are marked with *
0
Inquiry Basket