Recombinant Full Length Rhizobium Loti Phosphate Transport System Permease Protein Psta(Psta) Protein, His-Tagged
Cat.No. : | RFL17532RF |
Product Overview : | Recombinant Full Length Rhizobium loti Phosphate transport system permease protein pstA(pstA) Protein (Q98FL4) (1-283aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium loti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-283) |
Form : | Lyophilized powder |
AA Sequence : | MSTAASLHQSRKRKNGVMMMLCVVAAGIGLAWLALILGALLYKGLAGVSLSVFTEMTPPP GDAGGLLNAIYGSIVMTIIGIIVGTPIGVLAGTYMAEYGRFSKLTTVVRFINDILLSAPS IIIGLFVYELMVRPMGHFSAIAGAVALAILVIPVVVRTTEDMLNLVPNALREAGTAIGAP RWVVIRSVAYRAALSGIVTGILLAIARISGETAPLLFTALNNQFWSSNLNAPMASLPVTI FQFALSPYEEWQQLAWTGALIITLTVLALSIFARSLTGRREDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pstA |
Synonyms | pstA; mll3720; Phosphate transport system permease protein PstA |
UniProt ID | Q98FL4 |
◆ Recombinant Proteins | ||
AHCYL2-9492H | Recombinant Human AHCYL2 protein, His-tagged | +Inquiry |
ALPP-53H | Recombinant Human ALPP | +Inquiry |
RFL730SF | Recombinant Full Length Sclerotinia Sclerotiorum Golgi Apparatus Membrane Protein Tvp18(Tvp18) Protein, His-Tagged | +Inquiry |
HORMAD1-7783M | Recombinant Mouse HORMAD1 Protein | +Inquiry |
GTF3C6-4467H | Recombinant Human GTF3C6 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
AVD-3786C | Native Chicken AVD | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCHD3P1-4692HCL | Recombinant Human LOC387647 293 Cell Lysate | +Inquiry |
THEG-1098HCL | Recombinant Human THEG 293 Cell Lysate | +Inquiry |
GFRA2-2425HCL | Recombinant Human GFRA2 cell lysate | +Inquiry |
SLCO1A2-1690HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
STRADB-1385HCL | Recombinant Human STRADB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pstA Products
Required fields are marked with *
My Review for All pstA Products
Required fields are marked with *
0
Inquiry Basket