Recombinant Full Length Resistance To Inhibitors Of Cholinesterase Protein 3(Ric-3) Protein, His-Tagged
Cat.No. : | RFL6082CF |
Product Overview : | Recombinant Full Length Resistance to inhibitors of cholinesterase protein 3(ric-3) Protein (Q22472) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MPKTERRRDRDRDRDRERRNRRKRDDSYDDYDEEGGISGWKLGLVFGVIVVCFAMLYPTL FHPMLMGFLGRSPPSSPSINQQRPPIHPAMGGGSGQRHPGGGADVHPAMRMAQAQAESQS GGSKGMFTWMLPVYTIGVVLFLLYTLFKSKGKKSKRKKRNYFDSEDDDDESESETKYGGK FGKKKLEGLQKRLRETESAMSKILEQLESVQAGANPVDLDAADKRSEQLEEDPSVKEAVG LTETNEQYIKDLEVALKEFQSLSKEYDKAKMKKLKRKDSSSDEDEEDEEENSSELSEIEE EEEEVKPVKKSKSSSQSVGKRKNRPKSTSEEEDEGEEESRKVAEDAEEEGIDIDSEIREH AEKEKKDKNVRRRRPKKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ric-3 |
Synonyms | ric-3; des-5; T14A8.1; Resistance to inhibitors of cholinesterase protein 3 |
UniProt ID | Q22472 |
◆ Recombinant Proteins | ||
THNSL1-4514R | Recombinant Rhesus Macaque THNSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX25-2267M | Recombinant Mouse DDX25 Protein, His (Fc)-Avi-tagged | +Inquiry |
YRKI-3943B | Recombinant Bacillus subtilis YRKI protein, His-tagged | +Inquiry |
CSF1R-1320S | Recombinant Human CSF1R Protein (Y538-C972), GST tagged | +Inquiry |
MOBKL3-3383H | Recombinant Human MOBKL3, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
IBVF0704-224I | Native Influenza (B/Florida 07/04 ) IBVF0704 protein | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL8B-8704HCL | Recombinant Human ARL8B 293 Cell Lysate | +Inquiry |
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Fetal Frontal Lobe-141H | Human Fetal Frontal Lobe Lysate | +Inquiry |
GPR83-5776HCL | Recombinant Human GPR83 293 Cell Lysate | +Inquiry |
SERPINA1A-003MCL | Recombinant Mouse SERPINA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ric-3 Products
Required fields are marked with *
My Review for All ric-3 Products
Required fields are marked with *
0
Inquiry Basket