Recombinant Full Length Rat Voltage-Dependent Calcium Channel Gamma-3 Subunit(Cacng3) Protein, His-Tagged
Cat.No. : | RFL17065RF |
Product Overview : | Recombinant Full Length Rat Voltage-dependent calcium channel gamma-3 subunit(Cacng3) Protein (Q8VHX0) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cacng3 |
Synonyms | Cacng3; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3 |
UniProt ID | Q8VHX0 |
◆ Recombinant Proteins | ||
CACNG3-103C | Recombinant Cynomolgus Monkey CACNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNG3-1176M | Recombinant Mouse CACNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNG3-604R | Recombinant Rhesus monkey CACNG3 Protein, His-tagged | +Inquiry |
CACNG3-355C | Recombinant Cynomolgus CACNG3 Protein, His-tagged | +Inquiry |
CACNG3-1072R | Recombinant Rat CACNG3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACNG3-270HCL | Recombinant Human CACNG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cacng3 Products
Required fields are marked with *
My Review for All Cacng3 Products
Required fields are marked with *
0
Inquiry Basket