Recombinant Full Length Rat Vasoactive Intestinal Polypeptide Receptor 2(Vipr2) Protein, His-Tagged
Cat.No. : | RFL5519RF |
Product Overview : | Recombinant Full Length Rat Vasoactive intestinal polypeptide receptor 2(Vipr2) Protein (P35000) (23-437aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-437) |
Form : | Lyophilized powder |
AA Sequence : | ECRFHLEIQEEETKCAELLSSQMENHRACSGVWDNITCWRPADIGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKITFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGTLRCHDQPGSWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWIATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQPGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vipr2 |
Synonyms | Vipr2; Vasoactive intestinal polypeptide receptor 2; VIP-R-2; Pituitary adenylate cyclase-activating polypeptide type III receptor; PACAP type III receptor; PACAP-R-3; PACAP-R3 |
UniProt ID | P35000 |
◆ Recombinant Proteins | ||
VIPR2-6525R | Recombinant Rat VIPR2 Protein | +Inquiry |
VIPR2-2201H | Recombinant Human VIPR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Vipr2-6924M | Recombinant Mouse Vipr2 Protein, Myc/DDK-tagged | +Inquiry |
RFL34050HF | Recombinant Full Length Human Vasoactive Intestinal Polypeptide Receptor 2(Vipr2) Protein, His-Tagged | +Inquiry |
VIPR2-6181R | Recombinant Rat VIPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VIPR2-001HCL | Recombinant Human VIPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vipr2 Products
Required fields are marked with *
My Review for All Vipr2 Products
Required fields are marked with *
0
Inquiry Basket