Recombinant Full Length Rat Upf0458 Protein C7Orf42 Homolog Protein, His-Tagged
Cat.No. : | RFL25808RF |
Product Overview : | Recombinant Full Length Rat UPF0458 protein C7orf42 homolog Protein (Q6AY76) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MFSINPLENLKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLSNDTTTPESTMTIGQTRSSTQPPQSLEESGPINISVAITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPAAWNADDCALHGHCEQV VFTACMTLTAAPGVFPVTVQPPHCVPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALADA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem248 |
Synonyms | Tmem248; Transmembrane protein 248 |
UniProt ID | Q6AY76 |
◆ Recombinant Proteins | ||
LEP-25R | Recombinant Rabbit Leptin | +Inquiry |
Spata20-6077M | Recombinant Mouse Spata20 Protein, Myc/DDK-tagged | +Inquiry |
ECHS1-2811H | Recombinant Human ECHS1, His-tagged | +Inquiry |
IDE-0278H | Recombinant Human IDE protein, Twin-Strep-tagged | +Inquiry |
CAPN13-309H | Recombinant Human CAPN13 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM98-922HCL | Recombinant Human TMEM98 293 Cell Lysate | +Inquiry |
C20orf195-8121HCL | Recombinant Human C20orf195 293 Cell Lysate | +Inquiry |
TBRG4-1206HCL | Recombinant Human TBRG4 293 Cell Lysate | +Inquiry |
SPINK4-1582MCL | Recombinant Mouse SPINK4 cell lysate | +Inquiry |
PBK-713HCL | Recombinant Human PBK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem248 Products
Required fields are marked with *
My Review for All Tmem248 Products
Required fields are marked with *
0
Inquiry Basket