Recombinant Full Length Rat Upf0420 Protein C16Orf58 Homolog Protein, His-Tagged
Cat.No. : | RFL22896RF |
Product Overview : | Recombinant Full Length Rat UPF0420 protein C16orf58 homolog Protein (Q499P8) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MADTASLRAPLCTEQFGSGAPRSCSAAADGSLQWDRAQRWGWFSRASITKPGQHEGGGRG PWAALTTLSGLRSVLLPQGFPDSVSPDYLQYQLWDSVQAFASSLSGSLATQAVLQGLGVG NAKASVSAATSTWLVKDSTGMLGRIIFAWWKGSKLDCNAKQWRLFADILNDTAMFLEIMA PMYPIFFTMTVSTSNLAKCIVGVAGGATRAALTMHQARRNNMADVSAKDSSQETVVNLAG LLVSLLMLPLVSDCLSLSLGCFILLTALHIYANYRAVRALVLETLNESRLQLVLKHFLQR GEVLEPASANQMEPLWTGFWPSLSLSLGVPLHHLVSSVSELKQLVEGHQEPYLLCWNQSQ NQVQVALSQVAGPETVLRAATHGLILGALQEDGPLPGELAELRDMVQAGPKNESWILVRE THQVLDTLFPKFLKGLQAAGWKTEKHHLEVDEWRATWPLSPEKKVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UPF0420 protein C16orf58 homolog |
Synonyms | Rusf1; RUS family member 1 |
UniProt ID | Q499P8 |
◆ Native Proteins | ||
TNNI3-221H | Native Human TNNI3 | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Tf-392R | Native Rat Transferrin | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-516H | Human Testis Membrane Tumor Lysate | +Inquiry |
PPP1R17-7974HCL | Recombinant Human C7orf16 293 Cell Lysate | +Inquiry |
TGM3-577HCL | Recombinant Human TGM3 cell lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
Occipital lobe-348R | Rhesus monkey Occipital Lobe Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All UPF0420 protein C16orf58 homolog Products
Required fields are marked with *
My Review for All UPF0420 protein C16orf58 homolog Products
Required fields are marked with *
0
Inquiry Basket