Recombinant Human DLST protein(151-220 aa), C-His-tagged

• Cat.No.: DLST-2743H
• Product Overview: Recombinant Human DLST protein(P36957)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-220 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 9.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLR

Gene Information

• Gene Name: DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ]
• Official Symbol: DLST
• Synonyms: DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2
• Gene ID: 1743
• mRNA Refseq: NM_001244883
• Protein Refseq: NP_001231812
• MIM: 126063
• UniProt ID: P36957