Recombinant Full Length Rat Transmembrane Protein Ensp00000340100 Homolog Protein, His-Tagged
Cat.No. : | RFL7843RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein ENSP00000340100 homolog Protein (Q642A3) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MLIPPFILWDVGYSVYTYGSIFIIALIIWQVKRSHRGLRMGPTKSCAKCFRRIKQTPSDR ATRAKRTSKEEAEKLQKLLDTMKSQGWLPQEGSVRRLLCPDPSCSICNAMTLEIQQLLGV ENKKTSSSLLRPSRSFSCLEALSPSKSLADRSSELTYQDTRDVSLSSRFPQSQETDQQST RSATPSIGDAVLQCYHSAPQQQLDPQGSKMTQDAKGLSSSSTDEPGVPANQQKKRKKTKK LALKNQAAPTEVETENKMTFFSHWVNPEVKCDRQEESLVFSKYDTGAKPMTVEPEKTHSP VRDQAEGAEKKKKPECDLKAKPLRAKRNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fam205c |
Synonyms | Fam205c; Protein FAM205C |
UniProt ID | Q642A3 |
◆ Native Proteins | ||
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
◆ Cell & Tissue Lysates | ||
GK-5914HCL | Recombinant Human GK 293 Cell Lysate | +Inquiry |
RHOB-2356HCL | Recombinant Human RHOB 293 Cell Lysate | +Inquiry |
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
NCI-H23-041WCY | Human Lung Adenocarcinoma NCI-H23 Whole Cell Lysate | +Inquiry |
GAD2-001MCL | Recombinant Mouse GAD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fam205c Products
Required fields are marked with *
My Review for All Fam205c Products
Required fields are marked with *
0
Inquiry Basket