Recombinant Full Length Rat Transmembrane Protein C16Orf54 Homolog Protein, His-Tagged
Cat.No. : | RFL27736RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein C16orf54 homolog Protein (Q5BK39) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-225) |
Form : | Lyophilized powder |
AA Sequence : | MPATPQQPSGHTEGLTEPTSEAAMWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFR RPQPDPSQRAPTLVWRPGGELWIEPTSSARERSEDWYGSSIPLLMDRAPDPPTPGGTLEG RATAPPAIPTPHPSPSSLVPQTPPEVPAQSTFWRPQTQEESPYATGLVSWVGPEPMAEAG LEVGSPRAWRLRQGSLEPDWSLQPRVTLEQISAFWKREGRTSVGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Transmembrane protein C16orf54 homolog |
Synonyms | Transmembrane protein C16orf54 homolog |
UniProt ID | Q5BK39 |
◆ Native Proteins | ||
Calprotectin-12HFL | Native Human Calprotectin Protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL36AL-554HCL | Recombinant Human RPL36AL lysate | +Inquiry |
A431-030HCL | Human A431 Cell Nuclear Extract | +Inquiry |
CA4-001HCL | Recombinant Human CA4 cell lysate | +Inquiry |
UBE2G2-577HCL | Recombinant Human UBE2G2 293 Cell Lysate | +Inquiry |
RPUSD4-2150HCL | Recombinant Human RPUSD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Transmembrane protein C16orf54 homolog Products
Required fields are marked with *
My Review for All Transmembrane protein C16orf54 homolog Products
Required fields are marked with *
0
Inquiry Basket