Recombinant Full Length Rat Transmembrane Protein 246(Tmem246) Protein, His-Tagged
Cat.No. : | RFL24319RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein 246(Tmem246) Protein (Q5EB73) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem246 |
Synonyms | Pgap4; Tmem246; Post-GPI attachment to proteins factor 4; Post-GPI attachment to proteins GalNAc transferase 4; Transmembrane protein 246 |
UniProt ID | Q5EB73 |
◆ Recombinant Proteins | ||
FOXF1-3322M | Recombinant Mouse FOXF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTB4R-6133HF | Recombinant Full Length Human LTB4R Protein | +Inquiry |
NIT2-26962TH | Recombinant Human NIT2 | +Inquiry |
RFL14505VF | Recombinant Full Length Verticillium Albo-Atrum Signal Peptidase Complex Catalytic Subunit Sec11(Sec11) Protein, His-Tagged | +Inquiry |
SSP-RS07650-0143S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS07650 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C22orf32-8091HCL | Recombinant Human C22orf32 293 Cell Lysate | +Inquiry |
LTC4S-668HCL | Recombinant Human LTC4S cell lysate | +Inquiry |
PRTFDC1-2799HCL | Recombinant Human PRTFDC1 293 Cell Lysate | +Inquiry |
SPATA22-1536HCL | Recombinant Human SPATA22 293 Cell Lysate | +Inquiry |
DAPL1-7075HCL | Recombinant Human DAPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem246 Products
Required fields are marked with *
My Review for All Tmem246 Products
Required fields are marked with *
0
Inquiry Basket