Recombinant Full Length Rat Transmembrane Protein 109(Tmem109) Protein, His-Tagged
Cat.No. : | RFL27781RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein 109(Tmem109) Protein (Q6AYQ4) (34-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-243) |
Form : | Lyophilized powder |
AA Sequence : | QTHREFASPGQQKRESSADILTEIGRSLKETLDTWLGPETMHVISETLLQVMWAISSAIS VACFALSGIAAQLLSALGLDGEQLTQVLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVL ALLGRILGGLKLVLFVAGFVGLVRSVPDPSTRALLLLALLTVFALLSRLTGSRSSGTHLE AKVRGLERQIEELRGRQRRAAKIPRSMEEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem109 |
Synonyms | Tmem109; Transmembrane protein 109; Mitsugumin-23; Mg23 |
UniProt ID | Q6AYQ4 |
◆ Native Proteins | ||
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
PLG-30083TH | Native Human PLG | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM3-759HCL | Recombinant Human GSTM3 cell lysate | +Inquiry |
GUCY1B3-5676HCL | Recombinant Human GUCY1B3 293 Cell Lysate | +Inquiry |
ATP1B2-47HCL | Recombinant Human ATP1B2 lysate | +Inquiry |
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Thymus-128M | Mouse Thymus Tissue Lysate (14 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem109 Products
Required fields are marked with *
My Review for All Tmem109 Products
Required fields are marked with *
0
Inquiry Basket