Recombinant Full Length Rat Transmembrane And Coiled-Coil Domain-Containing Protein 4(Tmco4) Protein, His-Tagged
Cat.No. : | RFL7230RF |
Product Overview : | Recombinant Full Length Rat Transmembrane and coiled-coil domain-containing protein 4(Tmco4) Protein (Q499U8) (1-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-631) |
Form : | Lyophilized powder |
AA Sequence : | MATWNRPHPRLPVAPEPVAEGESQQPLGRELSEANRFAYAALCGISLSQLFPEPEQSSFC SEFVTGLVKWLHLSETVLPTMMAFASGLGGKGDDIFAQTLLKDPILKDNPSAISQDLLSF SLKDGHYDARARVLVCHVISLLQVPMEELDILEEVFLESLKDAKEEESETAEESRKRKEK RRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSVAGIAVMTSL FGAAGAGLTGYKMKKRVGAIEEFMFLPLTDGKQLHITIAITGWLGSGRYRTFNAPWMALA RSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTLPASLLSVA NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDC QGIIEDVVLLGAPVEGDPKYWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQ PVLLQDRRMENVDLSSVVNGHLDYAKKMDVILKAVGIRTKPGWSEKGLPLAPGGLPQEEP LQPATVSTDETIHQDEQKQGPAPGDSLKSAIPSSASQAQVPAGLDQSTEDSLPAAAAPAE GHLVCSHGVGPNPLGCPDCTRETQESCAELD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmco4 |
Synonyms | Tmco4; Transmembrane and coiled-coil domain-containing protein 4 |
UniProt ID | Q499U8 |
◆ Recombinant Proteins | ||
CD86-0873H | Recombinant Human CD86 Protein, His-Flag-StrepII-Tagged | +Inquiry |
CCND3-1831C | Recombinant Chicken CCND3 | +Inquiry |
AP2A2-9715H | Recombinant Human AP2A2, His-tagged | +Inquiry |
BIRC2-540R | Recombinant Rhesus monkey BIRC2 Protein, His-tagged | +Inquiry |
Galnt15-3143M | Recombinant Mouse Galnt15 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANK4-1279HCL | Recombinant Human PANK4 cell lysate | +Inquiry |
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Testis-777C | Chicken Testis Membrane Lysate, Total Protein | +Inquiry |
SLFN5-611HCL | Recombinant Human SLFN5 lysate | +Inquiry |
CAMK1G-506HCL | Recombinant Human CAMK1G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmco4 Products
Required fields are marked with *
My Review for All Tmco4 Products
Required fields are marked with *
0
Inquiry Basket