Recombinant Full Length Rat Taste Receptor Type 2 Member 117(Tas2R117) Protein, His-Tagged
Cat.No. : | RFL32080RF |
Product Overview : | Recombinant Full Length Rat Taste receptor type 2 member 117(Tas2r117) Protein (Q675B8) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MQHNLKTIFVISHSTLTIILFTELVTGIIGNGFMALVHCMDWLRRKKISLVNQILTALAI SRIFQLCLLFISLVISFSYPDLTTTSLIKVTCNLWIIVNHFNIWLATCLGIFYFLKISNF SNSLFLYLKWRVEKVVLVTLLVSLVLLTLNSLLINLEINICINEYQRNITYSFNSYYHAN CHRQMLSLHIIFLSVPFVLSLSTFLLLIFSLGTHHKKMQQHVQGRRDASTMAHFKALQTV IAFLLLYSIFILSVLVQIWKYELLKKNLFILFCQVAYVAFPSFHSYILILGDMKMRQACL SVLWWQKFRKNYVEPLDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tas2r117 |
Synonyms | Tas2r117; T2r39; Taste receptor type 2 member 117; T2R117; Taste receptor type 2 member 39; T2R39 |
UniProt ID | Q675B8 |
◆ Recombinant Proteins | ||
MPO-2943H | Recombinant Human MPO Protein, GST-tagged | +Inquiry |
KRTAP26-1-5810HF | Recombinant Full Length Human KRTAP26-1 Protein, GST-tagged | +Inquiry |
HDAC3-46H | Recombinant Human HDAC3 Protein, His-tagged | +Inquiry |
MLF1IP-1060H | Recombinant Human MLF1IP | +Inquiry |
IRF8-156H | Recombinant Human IRF8, His-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHN2-7528HCL | Recombinant Human CHN2 293 Cell Lysate | +Inquiry |
ACSS3-9067HCL | Recombinant Human ACSS3 293 Cell Lysate | +Inquiry |
TRIM47-1829HCL | Recombinant Human TRIM47 cell lysate | +Inquiry |
CDC37-648HCL | Recombinant Human CDC37 cell lysate | +Inquiry |
CTSA-3026HCL | Recombinant Human CTSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tas2r117 Products
Required fields are marked with *
My Review for All Tas2r117 Products
Required fields are marked with *
0
Inquiry Basket