Recombinant Full Length Rat Sphingomyelin Phosphodiesterase 2(Smpd2) Protein, His-Tagged
Cat.No. : | RFL1334RF |
Product Overview : | Recombinant Full Length Rat Sphingomyelin phosphodiesterase 2(Smpd2) Protein (Q9ET64) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MKHNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLESFDLALLEEVWSEQDFQYLK QKLSLTYPDAHYFRSGIIGSGLCVFSRHPIQEIVQHVYTLNGYPYKFYHGDWFCGKAVGL LVLHLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKKANVVLLCGDLN MHPKDLGCCLLKEWTGLRDAFVETEDFKGSEDGCTMVPKNCYVSQQDLGPFPFGVRIDYV LYKAVSGFHICCKTLKTTTGCDPHNGTPFSDHEALMATLCVKHSPPQEDPCSAHGSAERS ALISALREARTELGRGIAQARWWAALFGYVMILGLSLLVLLCVLAAGEEAREVAIMLWTP SVGLVLGAGAVYLFHKQEAKSLCRAQAEIQHVLTRTTETQDLGSEPHPTHCRQQEADRAE EK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Smpd2 |
Synonyms | Smpd2; Sphingomyelin phosphodiesterase 2; Lyso-platelet-activating factor-phospholipase C; Lyso-PAF-PLC; Neutral sphingomyelinase; N-SMase; nSMase |
UniProt ID | Q9ET64 |
◆ Recombinant Proteins | ||
SMPD2-4166R | Recombinant Rhesus Macaque SMPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMPD2-5624R | Recombinant Rat SMPD2 Protein | +Inquiry |
RFL1334RF | Recombinant Full Length Rat Sphingomyelin Phosphodiesterase 2(Smpd2) Protein, His-Tagged | +Inquiry |
SMPD2-4350R | Recombinant Rhesus monkey SMPD2 Protein, His-tagged | +Inquiry |
SMPD2-15640M | Recombinant Mouse SMPD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMPD2-614HCL | Recombinant Human SMPD2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Smpd2 Products
Required fields are marked with *
My Review for All Smpd2 Products
Required fields are marked with *
0
Inquiry Basket