Recombinant Full Length Rat Reticulon-4 Receptor-Like 1(Rtn4Rl1) Protein, His-Tagged
Cat.No. : | RFL6201RF |
Product Overview : | Recombinant Full Length Rat Reticulon-4 receptor-like 1(Rtn4rl1) Protein (Q80WD0) (25-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-424) |
Form : | Lyophilized powder |
AA Sequence : | CPRDCVCYPSPMTVSCQAHNFAAIPEGIPEDSERIFLQNNHITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSVVPCATPELRQGQDLKSLRVEDFRNCTGPASPHQIKSHTLSTSDRA ARKEHHPSHGASRDKGHPHGHLPGSRSGSKKPGKNCTSHRNRNQISKGSAGKELPELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rtn4rl1 |
Synonyms | Rtn4rl1; Ngrh2; Reticulon-4 receptor-like 1; Nogo receptor-like 2; Nogo-66 receptor homolog 2; Nogo-66 receptor-related protein 3; NgR3 |
UniProt ID | Q80WD0 |
◆ Recombinant Proteins | ||
RTN4RL1-4045H | Recombinant Human RTN4RL1 Protein (Cys25-Ala419), C-His tagged | +Inquiry |
RTN4RL1-5197R | Recombinant Rat RTN4RL1 Protein | +Inquiry |
RTN4RL1-161H | Recombinant Human RTN4RL1, His-tagged | +Inquiry |
RFL35743MF | Recombinant Full Length Mouse Reticulon-4 Receptor-Like 1(Rtn4Rl1) Protein, His-Tagged | +Inquiry |
RTN4RL1-618H | Recombinant Human RTN4RL1 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN4RL1-572HCL | Recombinant Human RTN4RL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rtn4rl1 Products
Required fields are marked with *
My Review for All Rtn4rl1 Products
Required fields are marked with *
0
Inquiry Basket