Recombinant Full Length Rat Prostaglandin E2 Receptor Ep3 Subtype(Ptger3) Protein, His-Tagged
Cat.No. : | RFL21274RF |
Product Overview : | Recombinant Full Length Rat Prostaglandin E2 receptor EP3 subtype(Ptger3) Protein (P34980) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MAGVWAPEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVVRSYRRRESK RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP GTWCFISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA AASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSVLMWS DQLER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ptger3 |
Synonyms | Ptger3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; Prostanoid EP3 receptor |
UniProt ID | P34980 |
◆ Recombinant Proteins | ||
Ntan1-4518M | Recombinant Mouse Ntan1 Protein, Myc/DDK-tagged | +Inquiry |
AHSA1-105R | Recombinant Rhesus Macaque AHSA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PANK1-3402H | Recombinant Human PANK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mllt1-4091M | Recombinant Mouse Mllt1 Protein, Myc/DDK-tagged | +Inquiry |
IL17B-0191H | Recombinant Human IL17B protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB121-6984HCL | Recombinant Human DEFB121 293 Cell Lysate | +Inquiry |
C17orf28-8240HCL | Recombinant Human C17orf28 293 Cell Lysate | +Inquiry |
RG9MTD1-2392HCL | Recombinant Human RG9MTD1 293 Cell Lysate | +Inquiry |
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
C11orf48-8350HCL | Recombinant Human C11orf48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ptger3 Products
Required fields are marked with *
My Review for All Ptger3 Products
Required fields are marked with *
0
Inquiry Basket