Recombinant Full Length Rat Phosphatidylserine Synthase 2(Ptdss2) Protein, His-Tagged
Cat.No. : | RFL8956RF |
Product Overview : | Recombinant Full Length Rat Phosphatidylserine synthase 2(Ptdss2) Protein (B2GV22) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MRRGERRVAGGSGSESPLLEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVHDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFI GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLLCNGLGIYCGM KTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIIL VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQA WLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKE TRRQKQQSHQAINNGDGHPGPEDDLPGTGTAEEEGTTNDGVPAEEGPSAAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ptdss2 |
Synonyms | Ptdss2; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II |
UniProt ID | B2GV22 |
◆ Recombinant Proteins | ||
PYRH-1045S | Recombinant Streptomyces coelicolor A3(2) PYRH protein, His-tagged | +Inquiry |
SAP014A-001-1849S | Recombinant Staphylococcus aureus (strain: CDC58, other: HA-MRSA) SAP014A_001 protein, His-tagged | +Inquiry |
EPHA3-8547HAF647 | Recombinant Human EPHA3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
MYF6-5801H | Recombinant Human MYF6 Protein, GST-tagged | +Inquiry |
FLNA-4155HFL | Recombinant Full Length Human FLNA protein | +Inquiry |
◆ Native Proteins | ||
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
PIV2-19 | Native Parainfluenza Virus Type 2 Antigen | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
GPR37L1-5786HCL | Recombinant Human GPR37L1 293 Cell Lysate | +Inquiry |
ADAMTS4-9029HCL | Recombinant Human ADAMTS4 293 Cell Lysate | +Inquiry |
SIX2-1824HCL | Recombinant Human SIX2 293 Cell Lysate | +Inquiry |
PAGE2B-468HCL | Recombinant Human PAGE2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ptdss2 Products
Required fields are marked with *
My Review for All Ptdss2 Products
Required fields are marked with *
0
Inquiry Basket