Recombinant Full Length Mouse Phosphatidylserine Synthase 2(Ptdss2) Protein, His-Tagged
Cat.No. : | RFL29794MF |
Product Overview : | Recombinant Full Length Mouse Phosphatidylserine synthase 2(Ptdss2) Protein (Q9Z1X2) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MRRGERRVAGGSGSESPLLKGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFI GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGM KTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIIL VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQA WLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKE TRRQKQQSHQARAVNNRDGHPGPDDDLLGTGTAEEEGTTNDGVTAEEGTSAAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ptdss2 |
Synonyms | Ptdss2; Pss2; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II |
UniProt ID | Q9Z1X2 |
◆ Recombinant Proteins | ||
RFL13370RF | Recombinant Full Length Rat Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
CFDP1-827R | Recombinant Rhesus monkey CFDP1 Protein, His-tagged | +Inquiry |
DCBLD2-209H | Recombinant Human DCBLD2, His tagged | +Inquiry |
APPB-1617B | Recombinant Bacillus subtilis APPB protein, His-tagged | +Inquiry |
SCO3672-542S | Recombinant Streptomyces coelicolor A3(2) SCO3672 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSAG2-7251HCL | Recombinant Human CSAG2 293 Cell Lysate | +Inquiry |
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
MDA-MB-361-01HL | Human MDA-MB-361 lysate | +Inquiry |
LHPP-4753HCL | Recombinant Human LHPP 293 Cell Lysate | +Inquiry |
PACSIN3-3472HCL | Recombinant Human PACSIN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ptdss2 Products
Required fields are marked with *
My Review for All Ptdss2 Products
Required fields are marked with *
0
Inquiry Basket