Recombinant Full Length Rat Olfactory Receptor 1500(Olr1500) Protein, His-Tagged
Cat.No. : | RFL32221RF |
Product Overview : | Recombinant Full Length Rat Olfactory receptor 1500(Olr1500) Protein (P23273) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MTGNNQTLILEFLLLGLPIPSEYHLLFYALFLAMYLTIILGNLLIIVLVRLDSHLHMPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSISYTGCLTQLYFFMVFGDMESFLLVVMAY DRYVAICFPLRYTTIMSTKFCASLVLLLWMLTMTHALLHTLLIARLSFCEKNVILHFFCD ISALLKLSCSDIYVNELMIYILGGLIIIIPFLLIVMSYVRIFFSILKFPSIQDIYKVFST CGSHLSVVTLFYGTIFGIYLCPSGNNSTVKEIAMAMMYTVVTPMLNPFIYSLRNRDMKRA LIRVICTKKISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Olr1500 |
Synonyms | Olr1500; Olfactory receptor 1500; Olfactory receptor-like protein I14 |
UniProt ID | P23273 |
◆ Recombinant Proteins | ||
LPO-4714H | Recombinant Human LPO Protein, GST-tagged | +Inquiry |
FXYD6-5280HF | Recombinant Full Length Human FXYD6 Protein, GST-tagged | +Inquiry |
LZTS2-1125H | Recombinant Human LZTS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VTCN1-7298HAF647 | Recombinant Human VTCN1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ACBD4-5039H | Recombinant Human ACBD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ULBP2-1790HCL | Recombinant Human ULBP2 cell lysate | +Inquiry |
TBC1D10A-1738HCL | Recombinant Human TBC1D10A cell lysate | +Inquiry |
HA-2367HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Stomach-578M | MiniPig Stomach Lysate, Total Protein | +Inquiry |
CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Olr1500 Products
Required fields are marked with *
My Review for All Olr1500 Products
Required fields are marked with *
0
Inquiry Basket