Recombinant Full Length Rat Olfactory Receptor 1493(Olr1493) Protein, His-Tagged
Cat.No. : | RFL15038RF |
Product Overview : | Recombinant Full Length Rat Olfactory receptor 1493(Olr1493) Protein (P23271) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MNNKTVITHFLLLGLPIPPEHQQLFFALFLIMYLTTFLGNLLIVVLVQLDSHLHTPMYLF LSNLSFSDLCFSSVTMLKLLQNIQSQVPSISYAGCLTQIFFFLLFGYLGNFLLVAMAYDR YVAICFPLHYTNIMSHKLCTCLLLVFWIMTSSHAMMHTLLAARLSFCENNVLLNFFCDLF VLLKLACSDTYVNELMIHIMGVIIIVIPFVLIVISYAKIISSILKVPSTQSIHKVFSTCG SHLSVVSLFYGTIIGLYLCPSGDNFSLKGSAMAMMYTVVTPMLNPFIYSLRNRDMKQALI RVTCSKKISLPW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Olr1493 |
Synonyms | Olr1493; Olfactory receptor 1493; Olfactory receptor-like protein I8 |
UniProt ID | P23271 |
◆ Recombinant Proteins | ||
FGFR3-5405H | Recombinant Human FGFR3 protein, His-tagged | +Inquiry |
KIFC1-2916R | Recombinant Rat KIFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLGN4Y-80H | Recombinant Human NLGN4Y Protein, His-tagged | +Inquiry |
GSDMD-722HF | Recombinant Full Length Human GSDMD Protein, GST-tagged | +Inquiry |
DPYSL5-1276H | Recombinant Human DPYSL5 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFB5-3904HCL | Recombinant Human NDUFB5 293 Cell Lysate | +Inquiry |
SLC25A11-1784HCL | Recombinant Human SLC25A11 293 Cell Lysate | +Inquiry |
RSL24D1-2132HCL | Recombinant Human RSL24D1 293 Cell Lysate | +Inquiry |
YTHDF3-235HCL | Recombinant Human YTHDF3 293 Cell Lysate | +Inquiry |
SPG7-1518HCL | Recombinant Human SPG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Olr1493 Products
Required fields are marked with *
My Review for All Olr1493 Products
Required fields are marked with *
0
Inquiry Basket