Recombinant Full Length Rat Neurotensin Receptor Type 1(Ntsr1) Protein, His-Tagged
Cat.No. : | RFL6993RF |
Product Overview : | Recombinant Full Length Rat Neurotensin receptor type 1(Ntsr1) Protein (P20789) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MHLNSSVPQGTPGEPDAQPFSGPQSEMEATFLALSLSNGSGNTSESDTAGPNSDLDVNTD IYSKVLVTAIYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLA MPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTL MSRSRTKKFISAIWLASALLAIPMLFTMGLQNRSGDGTHPGGLVCTPIVDTATVKVVIQV NTFMSFLFPMLVISILNTVIANKLTVMVHQAAEQGRVCTVGTHNGLEHSTFNMTIEPGRV QALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALFYV SSAINPILYNLVSANFRQVFLSTLACLCPGWRHRRKKRPTFSRKPNSMSSNHAFSTSATR ETLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ntsr1 |
Synonyms | Ntsr1; Ntsr; Neurotensin receptor type 1; NT-R-1; NTR1; High-affinity levocabastine-insensitive neurotensin receptor; NTRH |
UniProt ID | P20789 |
◆ Recombinant Proteins | ||
NTSR1-3690H | Recombinant Human NTSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTSR1-0294H | Recombinant Human NTSR1 Full Length Transmembrane protein, Flag tag(Nanodisc) | +Inquiry |
NTSR1-4527C | Recombinant Chicken NTSR1 | +Inquiry |
NTSR1-26H | Recombinant Human NTSR1 Protein | +Inquiry |
NTSR1-6783HF | Recombinant Full Length Human neurotensin receptor 1 Protein, Tag Free, Liposome | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ntsr1 Products
Required fields are marked with *
My Review for All Ntsr1 Products
Required fields are marked with *
0
Inquiry Basket