Recombinant Full Length Rat Neuropeptide Y Receptor Type 4(Ppyr1) Protein, His-Tagged
Cat.No. : | RFL25618RF |
Product Overview : | Recombinant Full Length Rat Neuropeptide Y receptor type 4(Ppyr1) Protein (Q63447) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MNTSHLMASLSPAFLQGKNGTNPLDSLYNLSDGCQDSADLLAFIITTYSVETVLGVLGNL CLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFI QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPFLANSIL NDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCVPLAFILVCYMRIYQR LQRQRRAFHTHTCSSRVGQMKRINGMLMAMVTAFAVLWLPLHVFNTLEDWYQEAIPACHG NLIFLMCHLFAMASTCVNPFIYGFLNINFKKDIKALVLTCRCRPPQGEPEPLPLSTVHTD LSKGSMRMGSKSNVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Npy4r |
Synonyms | Npy4r; Ppyr1; Neuropeptide Y receptor type 4; NPY4-R; Pancreatic polypeptide receptor 1; PP1 |
UniProt ID | Q63447 |
◆ Recombinant Proteins | ||
Nrxn3-1864M | Recombinant Mouse Nrxn3 Protein, His&GST-tagged | +Inquiry |
MB-2678C | Recombinant Chicken MB protein, His & T7-tagged | +Inquiry |
Erbb2-4099RAF555 | Recombinant Rat Erbb2 Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
RNF31-001H | Recombinant Human ring finger protein 31 Protein, His tagged | +Inquiry |
STAT2-4333R | Recombinant Rhesus Macaque STAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB1-774HCL | Recombinant Human LILRB1 cell lysate | +Inquiry |
EFCAB2-532HCL | Recombinant Human EFCAB2 cell lysate | +Inquiry |
CRISP3-7278HCL | Recombinant Human CRISP3 293 Cell Lysate | +Inquiry |
NBL1-1627MCL | Recombinant Mouse NBL1 cell lysate | +Inquiry |
KCNIP3-5053HCL | Recombinant Human KCNIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Npy4r Products
Required fields are marked with *
My Review for All Npy4r Products
Required fields are marked with *
0
Inquiry Basket