Recombinant Full Length Rat Monocyte To Macrophage Differentiation Protein(Mmd) Protein, His-Tagged
Cat.No. : | RFL22845RF |
Product Overview : | Recombinant Full Length Rat Monocyte to macrophage differentiation protein(Mmd) Protein (Q719N3) (1-238aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-238) |
Form : | Lyophilized powder |
AA Sequence : | MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mmd |
Synonyms | Mmd; Maf; Paqr11; Monocyte to macrophage differentiation factor; Macrophage/microglia activation-associated factor; MAF; Progestin and adipoQ receptor family member 11; Progestin and adipoQ receptor family member XI |
UniProt ID | Q719N3 |
◆ Native Proteins | ||
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
C3d-48HB | Native Human Complement C3d Protein, Biotinylated | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Uterus-808G | Guinea Pig Uterus Membrane Lysate, Total Protein | +Inquiry |
RABAC1-2576HCL | Recombinant Human RABAC1 293 Cell Lysate | +Inquiry |
HSPBAP1-5343HCL | Recombinant Human HSPBAP1 293 Cell Lysate | +Inquiry |
SESN2-1930HCL | Recombinant Human SESN2 293 Cell Lysate | +Inquiry |
PAX2-3419HCL | Recombinant Human PAX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mmd Products
Required fields are marked with *
My Review for All Mmd Products
Required fields are marked with *
0
Inquiry Basket