Recombinant Full Length Human MMD Protein, GST-tagged

• Cat.No.: MMD-6388HF
• Product Overview: Human MMD full-length ORF ( NP_036461.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 238 amino acids
• Description: This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq
• Molecular Mass: 54.1 kDa
• AA Sequence: MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MMD monocyte to macrophage differentiation-associated [ Homo sapiens ]
• Official Symbol: MMD
• Synonyms: MMD; monocyte to macrophage differentiation-associated; monocyte to macrophage differentiation protein; MMA; PAQR11; macrophage maturation-associated; progestin and adipoQ receptor family member 11; progestin and adipoQ receptor family member XI; MMD1
• Gene ID: 23531
• mRNA Refseq: NM_012329
• Protein Refseq: NP_036461
• MIM: 604467
• UniProt ID: Q15546