Recombinant Full Length Rat Macoilin(Tmem57) Protein, His-Tagged
Cat.No. : | RFL19464RF |
Product Overview : | Recombinant Full Length Rat Macoilin(Tmem57) Protein (Q4V7D3) (1-664aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-664) |
Form : | Lyophilized powder |
AA Sequence : | MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWL FIRSVYDSFRYQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGV CLPTVSLWILFVYIEAAIRFKDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRL RKQKEVQKENEFYMQLLQQALPPEQQMLQKQEKEAEEAAKGLPDMDSSILIHHNGGIPAN KKLSTALPEIEYREKGKEKDKDAKKHNLGINNNNILQPVDSKIQEIEYMENHINSKRLNN DLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKNEKKQRCTSKG PSAHKDLMENCIPNNQLSKPDALVRLEQDIKKLKADLQASRQVEQELRSQISSLSSTERG IRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKRLKAEQEARGFVEKQLMEEKKR KKLEEATAARAVAFAAASRGECTETLRSRIRELEAEGKKLTMDLKVKEEQIRELELKVQE LRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQI LQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQ PLKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Maco1 |
Synonyms | Maco1; Tmem57; Macoilin; Macoilin-1; Transmembrane protein 57 |
UniProt ID | Q4V7D3 |
◆ Recombinant Proteins | ||
RPS11-12555Z | Recombinant Zebrafish RPS11 | +Inquiry |
FKBP5-2124H | Recombinant Human FKBP5 protein, His-tagged | +Inquiry |
NDRG1-1398H | Recombinant Human N-myc Downstream Regulated 1, His-tagged | +Inquiry |
RFL14926EF | Recombinant Full Length Escherichia Coli O45:K1 Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged | +Inquiry |
ATP6V0B-9964Z | Recombinant Zebrafish ATP6V0B | +Inquiry |
◆ Native Proteins | ||
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASD2-2508HCL | Recombinant Human RASD2 293 Cell Lysate | +Inquiry |
CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
Skin-864R | Mini Rabbit Skin Membrane Lysate, Total Protein | +Inquiry |
DHCR24-6950HCL | Recombinant Human DHCR24 293 Cell Lysate | +Inquiry |
NRP1-811CCL | Recombinant Cynomolgus NRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Maco1 Products
Required fields are marked with *
My Review for All Maco1 Products
Required fields are marked with *
0
Inquiry Basket