Recombinant Full Length Rat Long-Chain-Fatty-Acid--Coa Ligase 5(Acsl5) Protein, His-Tagged
Cat.No. : | RFL-23345RF |
Product Overview : | Recombinant Full Length Rat Long-chain-fatty-acid--CoA ligase 5(Acsl5) Protein (O88813) (1-683aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-683) |
Form : | Lyophilized powder |
AA Sequence : | MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAFQKNNDLILYYFSDAKTLYEVFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGSCLLHKGYKPSQDQFIGIFAQNRPEWVISELACYTYSMVAVPLYDTLGAEAIIYVINRADISVVICDTPQKATMLIENVEKDLTPGLKTVILMDPFDDDLMKRGEKCGIEMLSLHDAENLGKENFKKPMPPNPEDLSVICFTSGTTGDPKGAMLTHQNIVSNMAAFLKFLEPIFQPTPEDVTISYLPLAHMFERLVQGVIFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVRNGIIRRNSLWDKLVFSKIQSSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTAGCSITSPGDWTAGHVGTPVSCNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENVYSRSRPILQVFVHGESLRSFLIGVVVPDPESLPSFAAKIGVKGSFEELCQNQCVKKAILEDLQKVGKEGGLKSFEQVKSIFVHPEPFSIENGLLTPTLKAKRVELAKFFQTQIKSLYESIEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Acsl5 |
Synonyms | Acsl5; Acs5; Facl5; Long-chain-fatty-acid--CoA ligase 5; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 5; LACS 5 |
UniProt ID | O88813 |
◆ Recombinant Proteins | ||
ACSL5-1924H | Recombinant Human ACSL5 Protein (33-683 aa), His-tagged | +Inquiry |
ACSL5-262H | Recombinant Human ACSL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSL5-200H | Recombinant Human ACSL5 Protein, GST-tagged | +Inquiry |
Acsl5-58M | Recombinant Mouse Acsl5 Protein, His-tagged | +Inquiry |
ACSL5-804HF | Recombinant Full Length Human ACSL5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL5-9073HCL | Recombinant Human ACSL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Acsl5 Products
Required fields are marked with *
My Review for All Acsl5 Products
Required fields are marked with *
0
Inquiry Basket