Recombinant Full Length Rat Lipid Phosphate Phosphatase-Related Protein Type 3(Lppr3) Protein, His-Tagged
Cat.No. : | RFL23427RF |
Product Overview : | Recombinant Full Length Rat Lipid phosphate phosphatase-related protein type 3(Lppr3) Protein (Q7TMB0) (1-716aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-716) |
Form : | Lyophilized powder |
AA Sequence : | MIAKKEKNKTPKDSMTLLPCFYFVELPIVASSVVSLYFLELTDLFQPAKVGFQCHDRSLS MPYVETNEELIPLLMLLSLAFAAPAASIMVGEGMVYCLQSRLWGRGPGGVEGSINAGGCN FNSFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCEANPY ITQDICSGHDTHAILSARKTFPSQHATLSAFAAVYVSMYFNSVISDATKLLKPILVFAFA IAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAAYLACHAVGNFQAPPAEKVPTPAPAKDA LRVLTQRGHESMYQQNKSVSTDELGPPGRLEGVPRPVAREKTSLGSLKRASVDVDLLAPR SPMGKEGMVTFSNTLPRVSTPSLDDPSRRHMTIHVPLDASRSRQLISEWKQKSLEGRGLG LPDEASPAHLRAPAEQVAEEEEEEEEEEEEEEEEEEEEEGPVPPSLYPTVQARPGLGPRV ILPPRPGPQPLIHIPEEVVQAGAGLSPKSSASVRAKWLSMVEKGGGPVAVAPPQPRVANP PRLLQVIAMSKAAGGPKAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLS AGSTPWEWKAKVVEGEGGYELGDLARGFRSSCKQPGIGPGSPVSDVDQEEPRFGAVATVN LATGEGLPPPGASEGALGAGSRESTLRRQVGALGEREVEAEAESYYRRMQARRYQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plppr3 |
Synonyms | Plppr3; Lppr3; Prg2; Phospholipid phosphatase-related protein type 3; Lipid phosphate phosphatase-related protein type 3; Plasticity-related gene 2 protein; PRG-2 |
UniProt ID | Q7TMB0 |
◆ Recombinant Proteins | ||
Cxcl10-525M | Recombinant Mouse Cxcl10 Protein, His-tagged | +Inquiry |
RFL767BF | Recombinant Full Length Burkholderia Pseudomallei Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
TNFRSF10A-0739H | Active Recombinant Human TNFRSF10A protein, His-tagged | +Inquiry |
MAP3K7CL-1473H | Recombinant Human MAP3K7CL protein, His & T7-tagged | +Inquiry |
CKAP4-2819M | Recombinant Mouse CKAP4 Protein (109-575 aa), His-MBP-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
C3c-11H | Native Human C3c Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMARCAD1-1670HCL | Recombinant Human SMARCAD1 293 Cell Lysate | +Inquiry |
KCNJ5-5044HCL | Recombinant Human KCNJ5 293 Cell Lysate | +Inquiry |
Testis-499C | Chicken Testis Lysate, Total Protein | +Inquiry |
GBP2-1337HCL | Recombinant Human GBP2 cell lysate | +Inquiry |
TMEM222-963HCL | Recombinant Human TMEM222 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plppr3 Products
Required fields are marked with *
My Review for All Plppr3 Products
Required fields are marked with *
0
Inquiry Basket