Recombinant Full Length Rat Epithelial Cell Adhesion Molecule(Epcam) Protein, His-Tagged
Cat.No. : | RFL3774RF |
Product Overview : | Recombinant Full Length Rat Epithelial cell adhesion molecule(Epcam) Protein (O55159) (24-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-315) |
Form : | Lyophilized powder |
AA Sequence : | QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Epcam |
Synonyms | Epcam; Tacstd1; Epithelial cell adhesion molecule; Ep-CAM; Epithelial glycoprotein 314; EGP314; Protein D5.7A; Tumor-associated calcium signal transducer 1; CD antigen CD326 |
UniProt ID | O55159 |
◆ Recombinant Proteins | ||
EPCAM-6765C | Recombinant Chicken EPCAM protein, His-tagged | +Inquiry |
EPCAM-1936C | Recombinant Chicken EPCAM | +Inquiry |
EPCAM-81HAF647 | Recombinant Human EPCAM Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
EPCAM-81HF | Recombinant Human EPCAM Protein, Fc-tagged, FITC conjugated | +Inquiry |
EPCAM-185C | Recombinant Cynomolgus EPCAM | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Epcam Products
Required fields are marked with *
My Review for All Epcam Products
Required fields are marked with *
0
Inquiry Basket