Recombinant Full Length Rat E3 Ubiquitin-Protein Ligase Rnf133(Rnf133) Protein, His-Tagged
Cat.No. : | RFL15674RF |
Product Overview : | Recombinant Full Length Rat E3 ubiquitin-protein ligase RNF133(Rnf133) Protein (Q6AY01) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MNPLQTGPWQTSAPSFWLLKFSFIWLVSQNCCTASAVWTAYMNISFHVGNRMLSELGETG VFGRSSILKRVAGVVVPPEGKIQNACDPNTSFILPRNKEPWIALIERGGCAFTQKIKVAS ENGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNVKGMEILHLIRKGVHVTVMVEVG RKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIEDRRWKRLTRELKKAFGQLQVR ILKEGDEEVSPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDI LKALGIQMDIEDGSDSLQVLMSNELPGTFSAMEEELNNELPPARTSSKVTHVQEHPTSVN VGSQPPEAEETGHPSFGQHDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf133 |
Synonyms | Rnf133; E3 ubiquitin-protein ligase RNF133; RING finger protein 133; RING-type E3 ubiquitin transferase RNF133 |
UniProt ID | Q6AY01 |
◆ Native Proteins | ||
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
C4orf36-8025HCL | Recombinant Human C4orf36 293 Cell Lysate | +Inquiry |
HeLa-025HCL | Human Etoposide Stimulated HeLa Whole Cell Lysate | +Inquiry |
ATP5C1-8603HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rnf133 Products
Required fields are marked with *
My Review for All Rnf133 Products
Required fields are marked with *
0
Inquiry Basket