Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf133(Rnf133) Protein, His-Tagged
Cat.No. : | RFL10179MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase RNF133(Rnf133) Protein (Q14B02) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MNPLQTSTWQNQAPSFWLLRFSFIWLVSQKCCTASAVWTAYMNISFHVGNRMLSELGETG VFGRSSILKRVAGVVVPPEGKIQNACDPNTTFILPRNKEPWIALIERGGCAFTQKIKVAS EHGARGVIIYNFPGTGNQVFPMSHQAFEDIVVVMIGNIKGMEILHLIRKGVHVTVMVEVG RKHVIWLNHYFVSFMIVTTATLAYFTFYHIRRLWVARIENRRWKRLTRELKKAFGQLQVR VLKEGDEEVNPNADSCVICFEAYKPNEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDI LKALGIQMDIEDGTDSLQVLMSNELPGTLSPVEEETNYELPPARTSSKVTHVQEHPTSSA NAGSQPPEAEETSHPSHGQQVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf133 |
Synonyms | Rnf133; Greul2; E3 ubiquitin-protein ligase RNF133; Goliath-related E3 ubiquitin-protein ligase 2; RING finger protein 133; RING-type E3 ubiquitin transferase RNF133 |
UniProt ID | Q14B02 |
◆ Recombinant Proteins | ||
IGSF11-1601H | Recombinant Human IGSF11 protein, His-tagged | +Inquiry |
PGD-2034H | Recombinant Human Phosphogluconate Dehydrogenase, His-tagged | +Inquiry |
WNT3-3076H | Recombinant Human WNT3 protein, His-tagged | +Inquiry |
FLT4-8117H | Active Recombinant Human FLT4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
LRRC15-0374C | Active Recombinant Cynomolgus / Rhesus macaque LRRC15 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Alb-113R | Native Rat Serum Albumin | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLECL1-8194HCL | Recombinant Human C19orf75 293 Cell Lysate | +Inquiry |
Medulla Oblongata-340C | Cynomolgus monkey Medulla Oblongata Lysate | +Inquiry |
PPP1R3C-2934HCL | Recombinant Human PPP1R3C 293 Cell Lysate | +Inquiry |
RNF11-2310HCL | Recombinant Human RNF11 293 Cell Lysate | +Inquiry |
COX11-7337HCL | Recombinant Human COX11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rnf133 Products
Required fields are marked with *
My Review for All Rnf133 Products
Required fields are marked with *
0
Inquiry Basket