Recombinant Full Length Rat Cyclic Nucleotide-Gated Cation Channel Alpha-4(Cnga4) Protein, His-Tagged
Cat.No. : | RFL23742RF |
Product Overview : | Recombinant Full Length Rat Cyclic nucleotide-gated cation channel alpha-4(Cnga4) Protein (Q64359) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MSQDGKVKTTESTPPAPTKARKWLPVLDPSGDYYYWWLNTMVFPIMYNLIIVVCRACFPD LQHSYLVAWFVLDYTSDLLYLLDIGVRFHTGFLEQGILVVDKGMIASRYVRTWSFLLDLA SLVPTDAAYVQLGPHIPTLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPLPDR EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNKRLE RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQAVMEEKGREILLKMNKLDV NAEAAEIALQEATESRLKGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP MPEDMGEADDEAEPGEGTSKDGEGKAGQAGPSGIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cnga4 |
Synonyms | Cnga4; Cgn2; Cyclic nucleotide-gated cation channel alpha-4; Cyclic nucleotide-gated channel alpha-4; CNG channel alpha-4; CNG-4; CNG4; Cyclic nucleotide-gated olfactory channel subunit OCNC2 |
UniProt ID | Q64359 |
◆ Recombinant Proteins | ||
WAS-6714H | Recombinant Human WAS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RMND5B-301135H | Recombinant Human RMND5B protein, GST-tagged | +Inquiry |
COPS2-1532R | Recombinant Rat COPS2 Protein | +Inquiry |
XRCC6-5925H | Recombinant Human XRCC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VASN-2895H | Recombinant Human VASN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
KRT19-169H | Native Human Cytokeratin 19 | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf152-7941HCL | Recombinant Human C9orf152 293 Cell Lysate | +Inquiry |
ARAF-105HCL | Recombinant Human ARAF cell lysate | +Inquiry |
ZBTB6-1956HCL | Recombinant Human ZBTB6 cell lysate | +Inquiry |
NAA10-002HCL | Recombinant Human NAA10 cell lysate | +Inquiry |
RNF144B-2293HCL | Recombinant Human RNF144B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Cnga4 Products
Required fields are marked with *
My Review for All Cnga4 Products
Required fields are marked with *
0
Inquiry Basket