Recombinant Full Length Rat Calcium Homeostasis Modulator Protein 2(Calhm2) Protein, His-Tagged
Cat.No. : | RFL4334RF |
Product Overview : | Recombinant Full Length Rat Calcium homeostasis modulator protein 2(Calhm2) Protein (Q5RJQ8) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-323) |
Form : | Lyophilized powder |
AA Sequence : | MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTA IGVPALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPTFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAGDEGFPPDHATEILARFPCGEGPANLSGFREEVSRRL KYESQLFGWLLIGVVAILVFLTKCFKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELVTKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLTGNGTAPDNVEMALLTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Calhm2 |
Synonyms | Calhm2; Fam26b; Calcium homeostasis modulator protein 2; Protein FAM26B |
UniProt ID | Q5RJQ8 |
◆ Recombinant Proteins | ||
Calhm2-1937M | Recombinant Mouse Calhm2 Protein, Myc/DDK-tagged | +Inquiry |
CALHM2-904Z | Recombinant Zebrafish CALHM2 | +Inquiry |
CALHM2-435R | Recombinant Rhesus Macaque CALHM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALHM2-1131H | Recombinant Human CALHM2 | +Inquiry |
RFL4334RF | Recombinant Full Length Rat Calcium Homeostasis Modulator Protein 2(Calhm2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALHM2-7891HCL | Recombinant Human CALHM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Calhm2 Products
Required fields are marked with *
My Review for All Calhm2 Products
Required fields are marked with *
0
Inquiry Basket