Recombinant Full Length Rat C-X-C Chemokine Receptor Type 5(Cxcr5) Protein, His-Tagged
Cat.No. : | RFL32348RF |
Product Overview : | Recombinant Full Length Rat C-X-C chemokine receptor type 5(Cxcr5) Protein (P34997) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MNSPISLDMGAITYNMDDLYKELAIYSNSTEIPLQDSIFCSTEEGPLLTSFKTIFMPVAY SLIFLLGMMGNILVLVILERHRHTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLG TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRRRRLLSIHITCSTIWLAGF LFALPELLFAKVVQPHNNESLPQCIFSQENEAETRAWFASRFLYHTGGFLLPMLVMAWCY VGVVHRLLQAQRRPQRQKAVRVAILVTSIFLLCWSPYHIVIFLDTLERLKAVNSSCELSG YLSVAITLCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPGWRKS SLSESENATSLTTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cxcr5 |
Synonyms | Cxcr5; Blr1; C-X-C chemokine receptor type 5; CXC-R5; CXCR-5; Burkitt lymphoma receptor 1 homolog; Neurolymphatic receptor; NLR; CD antigen CD185 |
UniProt ID | P34997 |
◆ Recombinant Proteins | ||
CXCR5-1354R | Recombinant Rat CXCR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR5-3350H | Recombinant Human CXCR5 protein, His-GST-tagged | +Inquiry |
CXCR5-3349H | Recombinant Human CXCR5 protein, His-tagged | +Inquiry |
CXCR5-1084HFL | Recombinant Human CXCR5 protein, His&Flag-tagged | +Inquiry |
CXCR5-912H | Active Recombinant Human CXCR5 Full Length Transmembrane protein(VLPs) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCR5-426HCL | Recombinant Human CXCR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcr5 Products
Required fields are marked with *
My Review for All Cxcr5 Products
Required fields are marked with *
0
Inquiry Basket