Recombinant Full Length Rat C-Type Lectin Domain Family 9 Member A(Clec9A) Protein, His-Tagged
Cat.No. : | RFL29558RF |
Product Overview : | Recombinant Full Length Rat C-type lectin domain family 9 member A(Clec9a) Protein (D4AD02) (1-241aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-241) |
Form : | Lyophilized powder |
AA Sequence : | MHEEEIYTSLQWDIPTSEASQKCPSLSKCPGTWCIVTVISCVVCVGLLAASIFLGIKFSQVSSLVMEQRERLIRQDTALLNLTEWQRNHTLQLKSCQASLQRSLRSGSNCNPCPPNWIQNGKSCYYAFDRWETWNNSKKSCLKEGDSLLQIDSKEEMEFINLSIWKLKGGYEYWVGVFQDGPSGSWFWEDGSSPLSDLLPTDRQLSASQICGYLKDHTLISDNCSNWKYFICEKKAFGSCI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Clec9a |
Synonyms | Clec9a; C-type lectin domain family 9 member A; CD antigen CD370 |
UniProt ID | D4AD02 |
◆ Recombinant Proteins | ||
Clec9a-981M | Recombinant Mouse Clec9a Protein, Fc-tagged | +Inquiry |
CLEC9A-2173HF | Recombinant Full Length Human CLEC9A Protein, GST-tagged | +Inquiry |
CLEC9A-01H | Active Recombinant Human CLEC9A Protein, Fc-tagged | +Inquiry |
CLEC9A-2092H | Recombinant Human CLEC9A Protein (Lys57-Val241), C-His tagged | +Inquiry |
CLEC9A-908R | Recombinant Rhesus monkey CLEC9A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC9A-363HCL | Recombinant Human CLEC9A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Clec9a Products
Required fields are marked with *
My Review for All Clec9a Products
Required fields are marked with *
0
Inquiry Basket