Recombinant Full Length Rana Esculenta Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL6840PF |
Product Overview : | Recombinant Full Length Rana esculenta Cannabinoid receptor 1(cnr1) Protein (Q333S9) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pelophylax esculentus (Edible frog) (Rana esculenta) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MKSVLDGLADTTFRTITTDLLYMGPNEVQYEDTKSDLSKLGYYPQKLPLSSYQEKIIDGQ STLHLDSFNATEFYNKSITTFKDGDGNIQCGNNFMDMECFMILTPSQQLVIAALSITLGT FTVLENMLVLCVIFQSRTLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRIDSPNV FLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLSYKRIVTRTKAVIAFCMMWTIAIVIA VLPLLGWNCKKLKSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHHHAVRM LQRGTQKSIIVHTSEDGKVHITRPDQTRMDIRLAKTLVLILVVLIICWGPLLAIMVYDVF GKMNKTVKTVFAFCCMLCLLNSTVNPIIYALRSKDLRSAFCSMFPNCEGTAQPLDNSMES DGQNRHAHNSNVHRAAESCIKSTVKIAKVTMSVSTDTSAEAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnr1 |
Synonyms | cnr1; Cannabinoid receptor 1; CB-R; CB1 |
UniProt ID | Q333S9 |
◆ Native Proteins | ||
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
FGB-01P | Native Porcine Fibrinogen Protein, FITC Labeled | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KA4-2160HCL | Recombinant Human RPS6KA4 293 Cell Lysate | +Inquiry |
Epididymis-739R | Rabbit Epididymis Lysate, Total Protein | +Inquiry |
TEC-1153HCL | Recombinant Human TEC 293 Cell Lysate | +Inquiry |
LYPD1-4592HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
COX6B2-7328HCL | Recombinant Human COX6B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cnr1 Products
Required fields are marked with *
My Review for All cnr1 Products
Required fields are marked with *
0
Inquiry Basket