Recombinant Full Length Ralstonia Metallidurans Nickel And Cobalt Resistance Protein Cnrb(Cnrb) Protein, His-Tagged
Cat.No. : | RFL2399CF |
Product Overview : | Recombinant Full Length Ralstonia metallidurans Nickel and cobalt resistance protein CnrB(cnrB) Protein (P37973) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cupriavidus metallidurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MMKNERRSVNWPMIAGVAAVAAAVGFGAAHLPVSEKSPASTQAPEAQKPQSAPVKPGLKE VKIPATYLAAANIAVEPVASAAVGTEILAPATVAALPGSEAVIVSRAAGAVQRVQRRLGD VVKAGDVLALVDSPEAAGMAAERKVAQAKADLARKTYEREASLFQQGVTPRQEMEAAKAA LDVAQAEALRAATVAQSAHLASDGRSVAVVSPIAGKITAQSVTLGAFVAPQAELFRVAGT GAVQVEAAVTAADTSRIVAGSEATILLANGSPLSARVQAVTPTVTGSARVATVVVVPAQP TDRLVVGEGVQVRLRTAVADAAALSVPEDAVQNLDGRDVLFVRTQEGFRPMPVLVGTRSG GSAQILSGVQAGEQVATRNAFLVKAEMNKGGGDEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnrB |
Synonyms | cnrB; Rmet_6209; RMe0084; Nickel and cobalt resistance protein CnrB |
UniProt ID | P37973 |
◆ Recombinant Proteins | ||
HLA-E&B2M-4643H | Recombinant Human HLA-E*01:03&B2M&Peptide (VMAPRTLVL) Tetramer protein, His-Avi-tagged, Biotinylated | +Inquiry |
C6orf141-0108H | Recombinant Human C6orf141 Protein, GST-Tagged | +Inquiry |
PTMA-671H | Recombinant Human PTMA Protein, His-tagged | +Inquiry |
GHR-555H | Recombinant Human GHR Protein, Biotinylated | +Inquiry |
Ntrk1-44RAF488 | Recombinant Rat Ntrk1 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
Chitosan-002C | Native Crawfish Chitosan | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35C2-1732HCL | Recombinant Human SLC35C2 293 Cell Lysate | +Inquiry |
FMO2-6183HCL | Recombinant Human FMO2 293 Cell Lysate | +Inquiry |
POLR2A-3037HCL | Recombinant Human POLR2A 293 Cell Lysate | +Inquiry |
PCBP1-3403HCL | Recombinant Human PCBP1 293 Cell Lysate | +Inquiry |
CYP3A5-7106HCL | Recombinant Human CYP3A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cnrB Products
Required fields are marked with *
My Review for All cnrB Products
Required fields are marked with *
0
Inquiry Basket