Recombinant Full Length Rabbit Udp-Glucuronosyltransferase 2B16(Ugt2B16) Protein, His-Tagged
Cat.No. : | RFL30007OF |
Product Overview : | Recombinant Full Length Rabbit UDP-glucuronosyltransferase 2B16(UGT2B16) Protein (O19103) (17-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-523) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVWPMEFSHWMNMKTILDALVQRGHAVTVLRSSASILVNSNDESGITFETFPTTSTK DEMEAFFMYWLNKLTNDVSKDALWEYFQTWQKFFMEYSDNYENICKDLVLNKKIMAKLQE SRFDVVLADPIAPCGELLAELLNRPLVYSVRFTPGYTYEKYSGGLLFPPSYVPVIMSDLS GQMTFMERVKNMLWMLYFDFWFQMLNVKRWDQFCSEVLGRPVTFSELVGKAEIWLIRSYW DLEFPRPLLPNSYFVGGLHCKPAQPLPKEMEEFVQSSGEEGVVVFSLGSMISNLTEERAN VIASTLAQLPQKVLWKFDGKKPDNLGTNTQLYKWIPQNDLLGHTVSKAFITHGGANGVFE AIYHGIPMVGLPLFADQHDNLAHMRAKGAAIRLDWKTMSSSDFLNALKTVINDPSYKEKA MTLSRIHHDQPMKPLDQAIFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACLT ITTYLVIKCWLLVYQNILMTGKKKKRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B16 |
Synonyms | UGT2B16; UDP-glucuronosyltransferase 2B16; UDPGT 2B16; Fragment |
UniProt ID | O19103 |
◆ Recombinant Proteins | ||
HOXC10-4973H | Recombinant Human HOXC10 Protein, GST-tagged | +Inquiry |
ABCB6-191M | Recombinant Mouse ABCB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
pGP3-D-6875C | Recombinant Chlamydia trachomatis pGP3-D protein, His-SUMO-tagged | +Inquiry |
KPNA2-2900H | Recombinant Human KPNA2, T7-tagged | +Inquiry |
IL12A-315H | Recombinant Human IL12A protein(Met1-Ser219), His-tagged | +Inquiry |
◆ Native Proteins | ||
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
RBP-246H | Native Human Retinol Binding Protein | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
TMEM182-981HCL | Recombinant Human TMEM182 293 Cell Lysate | +Inquiry |
AQPEP-654HCL | Recombinant Human AQPEP cell lysate | +Inquiry |
CIB2-7498HCL | Recombinant Human CIB2 293 Cell Lysate | +Inquiry |
TP63-472HCL | Recombinant Human TP63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B16 Products
Required fields are marked with *
My Review for All UGT2B16 Products
Required fields are marked with *
0
Inquiry Basket