Recombinant Full Length Rabbit Udp-Glucuronosyltransferase 2B13(Ugt2B13) Protein, His-Tagged
Cat.No. : | RFL29279OF |
Product Overview : | Recombinant Full Length Rabbit UDP-glucuronosyltransferase 2B13(UGT2B13) Protein (P36512) (25-531aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-531) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVWPMEFSHWMNMKTILDALVQQGHEVTVLRSSASIVIGSNNESGIKFETFHTSYRK DEIENFFMDWFYKMIYNVSIESYWETFSLTKMVILKYSDICEDICKEVILNKKLMTKLQE SRFDVVLADPVSPGGELLAELLKIPLVYSLRGFVGYMLQKHGGGLLLPPSYVPVMMSGLG SQMTFMERVQNLLCVLYFDFWFPKFNEKRWDQFYSEVLGRPVTFLELMGKADMWLIRSYW DLEFPRPLLPNFDFIGGLHCKPAKPLPQEMEDFVQSSGEEGVVVFSLGSMISNLTEERAN VIASALAQLPQKVLWRFEGKKPDMLGSNTRLYKWIPQNDLLGHPKTKAFITHGGANGVFE AIYHGIPMVGLPLFGDQLDNIVYMKAKGAAVKLNLKTMSSADLLNALKTVINDPSYKENA MTLSRIHHDQPMKPLDRAVFWIEYVMRHKGAKHLRVAAHDLTWYQYHSLDVIGFLLACVA ITTYLIVKCCLLVYRYVLGAGKKKKRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B13 |
Synonyms | UGT2B13; UDP-glucuronosyltransferase 2B13; UDPGT 2B13; EGT10 |
UniProt ID | P36512 |
◆ Native Proteins | ||
ACPP-8250H | Native Human Prostatic Acid Phosphatase | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT10-6039HCL | Recombinant Human GALNT10 293 Cell Lysate | +Inquiry |
HeLa-034HCL | Human HeLa Cell Nuclear Extract | +Inquiry |
RRP8-2140HCL | Recombinant Human RRP8 293 Cell Lysate | +Inquiry |
ERBB3-430HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
TEF-1152HCL | Recombinant Human TEF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B13 Products
Required fields are marked with *
My Review for All UGT2B13 Products
Required fields are marked with *
0
Inquiry Basket