Recombinant Full Length Rabbit Udp-Glucuronosyltransferase 1-6(Ugt1) Protein, His-Tagged
Cat.No. : | RFL34824OF |
Product Overview : | Recombinant Full Length Rabbit UDP-glucuronosyltransferase 1-6(UGT1) Protein (Q28611) (27-531aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-531) |
Form : | Lyophilized powder |
AA Sequence : | DRLLVVPQDGSHWLSMQDIVEALGARGHEIVVLVPEVNLLLRESRFYTRRIYPVPFDQEE QSYRYRTFGEKHFTDRSWLSGPQTEYRNNMVVIDMYFINCQSLLRHGDTLDFLRAGKFDA LFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHGFGGSPNPVSYIPRCYTKFSDQMSFP QRVVNFLVNLLEVPLFYCLYSKYEDLAVELLKREVDLPTLFQKDPVWLLRYDFVFEYPRP VMPNMVLIGGINCKKPDVLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIADALG KIPQTVLWRYTGSRPSNLAKNTYLVKWLPQNVLLGHPKTRAFITHSGSHGIYEGICNGVP MVMLPLFGDQMDNAKRIETRGAGVTLNVLEMTSDDLANALKTVINDKSYKENIMRLSSLH KDRPVEPLDLAVFWVEFVMRHKGAAPRPAAHDLTWYQYHSLDVIGFLLAIVLTVAFVTFK CCAFAWGKCFGKKGRVKKAHKSKVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT1 |
Synonyms | UGT1; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UGT1A6 |
UniProt ID | Q28611 |
◆ Recombinant Proteins | ||
ZEB1-22H | Recombinant Human ZEB1 Protein, GST-tagged | +Inquiry |
ACOT7-1761HF | Recombinant Full Length Human ACOT7 Protein, GST-tagged | +Inquiry |
SLC39A11-8362M | Recombinant Mouse SLC39A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30976SF | Recombinant Full Length Staphylococcus Saprophyticus Subsp. Saprophyticus Na(+)/H(+) Antiporter Subunit G1(Mnhg1) Protein, His-Tagged | +Inquiry |
CSTF2T-4006M | Recombinant Mouse CSTF2T Protein | +Inquiry |
◆ Native Proteins | ||
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
Plasminogen-87H | Native Human Plasminogen | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
VTN-31735TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPNE4-7308HCL | Recombinant Human CPNE4 293 Cell Lysate | +Inquiry |
COLO-383H | COLO 320HSR (human adenocarcinoma) nuclear extract lysate | +Inquiry |
MSLN-1343HCL | Recombinant Human MSLN cell lysate | +Inquiry |
LMO1-4711HCL | Recombinant Human LMO1 293 Cell Lysate | +Inquiry |
WDR19-1925HCL | Recombinant Human WDR19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT1 Products
Required fields are marked with *
My Review for All UGT1 Products
Required fields are marked with *
0
Inquiry Basket