Recombinant Full Length Rabbit Udp-Glucuronosyltransferase 1-4(Ugt1) Protein, His-Tagged
Cat.No. : | RFL6804OF |
Product Overview : | Recombinant Full Length Rabbit UDP-glucuronosyltransferase 1-4(UGT1) Protein (Q28612) (28-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (28-532) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVVPMDGSPWLSLREVVRDVHARGHQVLVLGPEVTMHIKGEDFFTLQTYATPYSKEE FDQLMQRNYQMIFKPQHSLKTLLETMENLKKFSMLCSRSCWELLHNKPLIKHLNESSFDV VLTDPLDLCGALLAKYLSVPSVFLLRFILCDLDFEGTQCPNPSSYIPRMLTMNSDHMSFL QRVKNMLYPLMMKYTCHISYDPYASLASELFQREVSLVDILSHASVWLFREDFVLDYPRP IMPNMVFIGGINCANRKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIADALG KIPQTVLWRYTGSRPSNLAKNTYLVKWLPQNVLLGHPKTRAFITHSGSHGIYEGICNGVP MVMLPLFGDQMDNAKRIETRGAGVTLNVLEMTSDDLANALKTVINDKSYKENIMRLSSLH KDRPVEPLDLAVFWVEFVMRHKGAAPRPAAHDLTWYQYHSLDVIGFLLAIVLTVAFVTFK CCAFAWGKCFGKKGRVKKAHKSKVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT1 |
Synonyms | Ugt1a4; UDP-glucuronosyltransferase 1A4; UGT1A4; UDP-glucuronosyltransferase 1-4; UDPGT 1-4; UGT1*4; UGT1-04; UGT1.4 |
UniProt ID | Q28612 |
◆ Recombinant Proteins | ||
BRDT-1089M | Recombinant Mouse BRDT Protein, His (Fc)-Avi-tagged | +Inquiry |
INHBA-552H | Recombinant Human INHBA Protein | +Inquiry |
HABP2-2433R | Recombinant Rat HABP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFBP5-3010R | Recombinant Rat IGFBP5 Protein | +Inquiry |
Olr1-1887R | Recombinant Rat Olr1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIPF2-738HCL | Recombinant Human YIPF2 lysate | +Inquiry |
TEX12-663HCL | Recombinant Human TEX12 lysate | +Inquiry |
SURF1-1337HCL | Recombinant Human SURF1 293 Cell Lysate | +Inquiry |
SLC28A2-1745HCL | Recombinant Human SLC28A2 293 Cell Lysate | +Inquiry |
ABRA-9121HCL | Recombinant Human ABRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT1 Products
Required fields are marked with *
My Review for All UGT1 Products
Required fields are marked with *
0
Inquiry Basket