Recombinant Full Length Rabbit Transient Receptor Potential Cation Channel Subfamily V Member 5(Trpv5) Protein, His-Tagged
Cat.No. : | RFL34963OF |
Product Overview : | Recombinant Full Length Rabbit Transient receptor potential cation channel subfamily V member 5(Trpv5) Protein (Q9XSM3) (1-730aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-730) |
Form : | Lyophilized powder |
AA Sequence : | MGACPPKAKGPWAQLQKLLISWPVGEQDWEQYRDRVNMLQQERIRDSPLLQAAKENDLRL LKILLLNQSCDFQQRGAVGETALHVAALYDNLEAATLLMEAAPELAKEPALCEPFVGQTA LHIAVMNQNLNLVRALLARGASVSARATGAAFRRSPHNLIYYGEHPLSFAACVGSEEIVR LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDEHSDHLQSLELVPNHQG LTPFKLAGVEGNTVMFQHLMQKRKHVQWTCGPLTSTLYDLTEIDSWGEELSFLELVVSSK KREARQILEQTPVKELVSFKWKKYGRPYFCVLASLYILYMICFTTCCIYRPLKLRDDNRT DPRDITILQQKLLQEAYVTHQDNIRLVGELVTVTGAVIILLLEIPDIFRVGASRYFGQTI LGGPFHVIIITYASLVLLTMVMRLTNMNGEVVPLSFALVLGWCSVMYFARGFQMLGPFTI MIQKMIFGDLMRFCWLMAVVILGFASAFHITFQTEDPNNLGEFSDYPTALFSTFELFLTI IDGPANYSVDLPFMYCITYAAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVAT TVMLERKMPRFLWPRSGICGYEYGLGDRWFLRVENHHDQNPLRVLRYVEAFKCSDKEDGQ EQLSEKRPSTVESGMLSRASVAFQTPSLSRTTSQSSNSHRGWEILRRNTLGHLNLGLDLG EGDGEEVYHF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Trpv5 |
Synonyms | Trpv5; Ecac1; Transient receptor potential cation channel subfamily V member 5; TrpV5; Epithelial calcium channel 1; Osm-9-like TRP channel 3; OTRPC3 |
UniProt ID | Q9XSM3 |
◆ Recombinant Proteins | ||
SLC35F3-8344M | Recombinant Mouse SLC35F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FEM1C-1686R | Recombinant Rhesus monkey FEM1C Protein, His-tagged | +Inquiry |
EID2-2693M | Recombinant Mouse EID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
YTQB-2205B | Recombinant Bacillus subtilis YTQB protein, His-tagged | +Inquiry |
RFL33936HF | Recombinant Full Length Human Transmembrane Protein 198(Tmem198) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Squash-711P | Squash Lysate, Total Protein | +Inquiry |
ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
ESAM-1569RCL | Recombinant Rat ESAM cell lysate | +Inquiry |
SCYL2-1574HCL | Recombinant Human SCYL2 cell lysate | +Inquiry |
AMICA1-001MCL | Recombinant Mouse AMICA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Trpv5 Products
Required fields are marked with *
My Review for All Trpv5 Products
Required fields are marked with *
0
Inquiry Basket