Recombinant Full Length Rabbit Cd166 Antigen(Alcam) Protein, His-Tagged
Cat.No. : | RFL-3406OF |
Product Overview : | Recombinant Full Length Rabbit CD166 antigen(ALCAM) Protein (O46651) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | GSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDDVF EAPTVVKVFKQPSKPEIVSKAPFLETEQLQKLGDCISRDSYPEGNITWYRNGKVLQPLEG AVVIIFKKQMDPVTQLYTMTSSLEYKTTKADIQTPFTCSITYYGPSGQKTVHSEQAVFDI YYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFFFYLPGQPEGIRSSNTYTLPN VRRNATGNYKCSLIDKKSLIASTAITVHYLDLSLNPXGELTKQIGDSLPVSCTISAIRNA TVVWMKDNIKLRSSPSFSSLQYQDAGNYVCETALQEVEGLKKRESLTLIVEVKPQIKMTK KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVT LTCAAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALV AGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALCAM |
Synonyms | ALCAM; CD166 antigen; Activated leukocyte cell adhesion molecule; SB-10 antigen; CD antigen CD166; Fragment |
UniProt ID | O46651 |
◆ Recombinant Proteins | ||
ALCAM-505H | Recombinant Human ALCAM protein, His-tagged | +Inquiry |
Alcam-7465R | Active Recombinant Rat Alcam protein(Met1-Lys527), His-tagged | +Inquiry |
ALCAM-1396HF | Recombinant Full Length Human ALCAM Protein, GST-tagged | +Inquiry |
Alcam-18R | Recombinant Rat Alcam, Fc tagged | +Inquiry |
RFL-36899CF | Recombinant Full Length Dog Cd166 Antigen(Alcam) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALCAM-828RCL | Recombinant Rat ALCAM cell lysate | +Inquiry |
ALCAM-2644MCL | Recombinant Mouse ALCAM cell lysate | +Inquiry |
ALCAM-1098CCL | Recombinant Cynomolgus ALCAM cell lysate | +Inquiry |
ALCAM-2294HCL | Recombinant Human ALCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALCAM Products
Required fields are marked with *
My Review for All ALCAM Products
Required fields are marked with *
0
Inquiry Basket