Recombinant Full Length Pyrenophora Tritici-Repentis Bifunctional Lycopene Cyclase/Phytoene Synthase (Ptrg_07366) Protein, His-Tagged
Cat.No. : | RFL34273PF |
Product Overview : | Recombinant Full Length Pyrenophora tritici-repentis Bifunctional lycopene cyclase/phytoene synthase (PTRG_07366) Protein (B2WAQ3) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrenophora tritici-repentis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MGFDYALVHLKYTIPPAVLLTWLYRPFFTKLDVYKVGYLVSIAVASTIPWDSYLIRTGIW SYPTHVIIGPKLCDIPLEEVFFFIIQTYNTSLLYLLLSRPTFQPVYLNTERGAARRQWRY MRLAGQVFFLALIAWGWRCIRHGGLGTYTGLILVWAGPFLLMLWSLAYQFILALPVTNTA LPIFLPTLYLWVVDTLALRRGTWVISTGTKYGLHLWDGLEIEEALFFLATNALIVFGQLA FDNALAVLYTFPHLFTGPSLLPSPVLLMRALLTPCSKYHDARIKGLDEAVNRLKRKSRSF YLASATFPGPLRADLLLLYSFCRVADDLVDNASDADEARAWIAKMRKFLNNVYSDKLPQS VVHSQICDDFPPSTQSALLQLPATKLSPQPLEDLLHGFEMDLAFQQGPIIRTMEDLRVYS ERVAGTVAQMCIQLIFYWYPSTLDTEEKNVIVAAGNSMGVALQYVNIARDIEVDAQIGRV YLPLNWLSEAGLSYDDVLKKPNQAQIQTLRKHLLNHAFSVYEKAKDSIERLPIEARGPIR VAVESYMEIGRILRSEQYQVKAGRATVPKSRRIMVAWRTLNSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTRG_07366 |
Synonyms | PTRG_07366; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | B2WAQ3 |
◆ Recombinant Proteins | ||
GIPC1-004H | Recombinant Human GIPC1 Protein, MYC/DDK-tagged | +Inquiry |
KLHL12-2934R | Recombinant Rat KLHL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM106B-1930C | Recombinant Chicken TMEM106B | +Inquiry |
RAET1D-7398M | Recombinant Mouse RAET1D Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTP1-1215H | Recombinant Human GSTP1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
NUC-0003 | Native Human Nucleosome | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRELP-001HCL | Recombinant Human PRELP cell lysate | +Inquiry |
MCM5-4417HCL | Recombinant Human MCM5 293 Cell Lysate | +Inquiry |
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
IL23-983MCL | Recombinant Marmoset IL23 cell lysate | +Inquiry |
GOLGA5-727HCL | Recombinant Human GOLGA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTRG_07366 Products
Required fields are marked with *
My Review for All PTRG_07366 Products
Required fields are marked with *
0
Inquiry Basket