Recombinant Full Length Putative Zinc Metalloprotease Spym18_2031(Spym18_2031) Protein, His-Tagged
Cat.No. : | RFL26298SF |
Product Overview : | Recombinant Full Length Putative zinc metalloprotease spyM18_2031(spyM18_2031) Protein (Q8NZB3) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pyogenes serotype M18 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MLGIITFIIIFGILVIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRML PLGGYVRMAGWGDDKTEIKTGTPASLTLNEQGFVKRINLSQSKLDPTSLPMHVTGYDLED QLSITGLVLEETKTYKVAHDATIVEEDGTEIRIAPLDVQYQNASIGGRLITNFAGPMNNF ILGIVVFILLVFLQGGMPDFSSNHVRVQENGAAAKAGLRDNDQIVAINGYKVTSWNDLTE AVDLATRDLGPSQTIKVTYKSHQRLKTVAVKPQKHAKTYTIGVKASLKTGFKDKLLGGLE LAWSGAFTILNALKGLITGFSLNKLGGPVAMYDMSNQAAQNGLESVLSLMAMLSINLGIF NLIPIPALDGGKILMNIIEAIRRKPIKQETEAYITLAGVAIMVVLMIAVTWNDIMRVFF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spyM18_2031 |
Synonyms | spyM18_2031; Putative zinc metalloprotease spyM18_2031 |
UniProt ID | Q8NZB3 |
◆ Recombinant Proteins | ||
RAB26-4104H | Recombinant Human RAB26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EPHX2-1928Z | Recombinant Zebrafish EPHX2 | +Inquiry |
LILRB4-392C | Recombinant Cynomolgus LILRB4 protein, Mouse IgG2a Fc-tagged | +Inquiry |
CLDN1-11283H | Recombinant Human CLDN1, GST-tagged | +Inquiry |
RFL3790SF | Recombinant Full Length Pig Alpha-1D Adrenergic Receptor(Adra1D) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RB-2677HCL | Recombinant Human IL10RB cell lysate | +Inquiry |
EPN2-6580HCL | Recombinant Human EPN2 293 Cell Lysate | +Inquiry |
WDR5-344HCL | Recombinant Human WDR5 293 Cell Lysate | +Inquiry |
CYSTM1-8015HCL | Recombinant Human C5orf32 293 Cell Lysate | +Inquiry |
Pons-396H | Human Pons (Alzheimers Disease) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All spyM18_2031 Products
Required fields are marked with *
My Review for All spyM18_2031 Products
Required fields are marked with *
0
Inquiry Basket