Recombinant Full Length Putative Zinc Metalloprotease Spy_1963/M5005_Spy1674(Spy_1963, M5005_Spy1674) Protein, His-Tagged
Cat.No. : | RFL34467SF |
Product Overview : | Recombinant Full Length Putative zinc metalloprotease SPy_1963/M5005_Spy1674(SPy_1963, M5005_Spy1674) Protein (Q99XY3) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pyogenes serotype M1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MLGIITFIIIFGILVIVHEFGHFYFAKKSGILVREFAIGMGPKIFSHVDQGGTLYTLRML PLGGYVRMAGWGDDKTEIKTGTPASLTLNEQGFVKRINLSQSKLDPTSLPMHVTGYDLED QLSITGLVLEETKTYKVAHDATIVEEDGTEIRIAPLDVQYQNASIGGRLITNFAGPMNNF ILGIVVFILLVFLQGGMPDFSSNHVRVQENGAAAKAGLRDNDQIVAINGYKVTSWNDLTE AVDLATRDLGPSQTIKVTYKSHQRLKTVAVKPQKHAKTYTIGVKASLKTGFKDKLLGGLE LAWSRAFTILNALKGLITGFSLNKLGGPVAMYDMSNQAAQNGLESVLSLMAMLSINLGIF NLIPIPALDGGKILMNIIEAIRRKPIKQETEAYITLAGVAIMVVLMIAVTWNDIMRVFF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPy_1963 |
Synonyms | SPy_1963; M5005_Spy1674; Putative zinc metalloprotease SPy_1963/M5005_Spy1674 |
UniProt ID | Q99XY3 |
◆ Recombinant Proteins | ||
RBBP4-6415C | Recombinant Chicken RBBP4 | +Inquiry |
MHC1LAA-2621Z | Recombinant Zebrafish MHC1LAA | +Inquiry |
MPXV-0848 | Recombinant Monkeypox Virus Protein, RNA polymerase-associated transcription-specificity factor RAP94 | +Inquiry |
TRIM71-9623M | Recombinant Mouse TRIM71 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC42EP4A-401Z | Recombinant Zebrafish CDC42EP4A | +Inquiry |
◆ Native Proteins | ||
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
RV-17 | Native Rotavirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC24-7771HCL | Recombinant Human CCDC24 293 Cell Lysate | +Inquiry |
NOVA1-3753HCL | Recombinant Human NOVA1 293 Cell Lysate | +Inquiry |
PILRA-001HCL | Recombinant Human PILRA cell lysate | +Inquiry |
MIER2-4317HCL | Recombinant Human MIER2 293 Cell Lysate | +Inquiry |
Skeletal Muscle-433H | Human Skeletal Muscle Membrane Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPy_1963 Products
Required fields are marked with *
My Review for All SPy_1963 Products
Required fields are marked with *
0
Inquiry Basket